PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0100900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 237aa    MW: 25297.3 Da    PI: 8.4781
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0100900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-3943101361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     e+al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk++
  Spipo1G0100900  43 EHALNCPRCQSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRT 101
                     6789*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2839100IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3444100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09646100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDTAQWPQDM GLTKSSMEGM MVPSGCTTAR PQLMERRPRP PREHALNCPR CQSTNTKFCY  60
YNNYSLSQPR YFCKTCRRYW TEGGSLRNVP VGGGSRKNKR TGDFCSTVSP NPLTCSSAAS  120
SGAQSAMDLL RGGVSCKGMS PFLPLMMAPD GGTVYSAGFG LQDFRSSSIN FPVDGIAGDG  180
GYGNVQDGSG RLFFPFEDLR RQVSSGDADV DQSRGQGGDP SVFWNGVIGG GGGASW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252779.11e-72PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLB9GK993e-69B9GK99_POPTR; DNA binding with one finger 7 family protein
STRINGPOPTR_0001s11130.17e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.34e-45Dof family protein